The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and ligand binding properties of myoglobins reconstituted with monodepropionated heme: functional role of each heme propionate side chain. Biochemistry 46 9406-9416 2007
    Site RSGI
    PDB Id 2eku Target Id my_001000022.2
    Molecular Characteristics
    Source Physeter catodon
    Alias Ids TPS13689, Molecular Weight 17330.21 Da.
    Residues 154 Isoelectric Point 8.70
    Sequence mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkasedlkkhgvtv ltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhpgdfgadaqgamnkalel frkdiaakykelgyqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.1945
    Matthews' coefficent 1.87 Rfactor
    Waters 204 Solvent Content 34.30

    Ligand Information


    Google Scholar output for 2eku

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch