The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of PH1811 protein from Pyrococcus horikoshii. To be Published
    Site RSGI
    PDB Id 2ekn Target Id pho001001811.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14006, Molecular Weight 17650.86 Da.
    Residues 159 Isoelectric Point 7.74
    Sequence mvgglthvdekgvkmveigykdvvfrkavakgriklkpetvklikegkiekgnvlataqiagilavkrt peliplchpipitgvditfdfgedyievtcevrayyktgvemealtgvtvallaiwdmvkavekdekgq ypytrienvhvvekvkthnsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.05 Rfree 0.21
    Matthews' coefficent 2.50 Rfactor 0.19
    Waters 271 Solvent Content 50.85

    Ligand Information
    Ligands FLC (CITRATE) x 2


    Google Scholar output for 2ekn

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch