.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ekd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID PH0250 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2ekd Target Id pho001000250.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13806, Molecular Weight 23587.31 Da.
    Residues 207 Isoelectric Point 5.54
    Sequence mqmnsekffklfrvgetvlveysgtsraelllyyivnnsklpivvddildtyyefytrlkvagfdvapl envqvikmggtkdigrvigrlniskyviseqeymeivsqlkdypvinpvlglhklillgntfeninvvk mvsnyvgreeriafyfvnrnviekhsspildlleevvtsileitdsgiiikksikdeiagkivspllnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.30 Rfree 0.225
    Matthews' coefficent 2.11 Rfactor 0.188
    Waters 663 Solvent Content 41.63

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 2ekd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch