.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ekc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID aq_1548 from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2ekc Target Id aae001001548.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12070, Molecular Weight 29500.75 Da.
    Residues 262 Isoelectric Point 6.30
    Sequence mgrisdkftelkekrekalvsylmvgypdyetslkafkevlkngtdileigfpfsdpvadgptiqvahe valkngirfedvlelsetlrkefpdipfllmtyynpifriglekfcrlsrekgidgfivpdlppeeaee lkavmkkyvlsfvplgaptstrkrikliceaademtyfvsvtgttgareklpyerikkkveeyrelcdk pvvvgfgvskkehareigsfadgvvvgsalvklagqkkiedlgnlvkelkeglre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.220
    Matthews' coefficent 2.32 Rfactor 0.184
    Waters 614 Solvent Content 46.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ekc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch