.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ek6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Human RNA-Binding Protein 12. To be Published
    Site RSGI
    PDB Id 2ek6 Target Id hsk002100747.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12729, Molecular Weight 8925.77 Da.
    Residues 82 Isoelectric Point 5.24
    Sequence sssgkpgptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataavid lndrpigsrkvkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.38 Rfree 0.231
    Matthews' coefficent 2.45 Rfactor 0.167
    Waters 184 Solvent Content 49.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ek6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch