.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ejz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID PH0725 from Pyrococcus horikoshii OT3 (Y11M). To be Published
    Site RSGI
    PDB Id 2ejz Target Id pho001000725.48
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13899, Molecular Weight 29542.80 Da.
    Residues 265 Isoelectric Point 5.76
    Sequence mvlyfiglglmderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfen ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.242
    Matthews' coefficent 3.26 Rfactor 0.213
    Waters 470 Solvent Content 62.23

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2;GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 2ejz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch