The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Homoserine Dehydrogenase from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ejw Target Id ttk003000026.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14167, Molecular Weight 35489.85 Da.
    Residues 332 Isoelectric Point 5.22
    Sequence mealkiallgggtvgsafynlvleraeelsafgvvprflgvlvrdprkpraipqellraepfdlleadl vveamggveaplrlvlpaleagiplitankallaeaweslrpfaeegliyheasvmagtpalsfletlr gsellelhgilngttlyilqemekgrtyaealleaqrlgyaeadptldvegidaahkltllarllvdpg fpfaeveaqgiarltpevlqkaeargervrlvaslfgeggrwraavaprrlpqdhplarargnalwvra rplgeafvtgpgagggatasglfadllrflsgapghlpaprarppleegspwpgve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.238
    Matthews' coefficent 2.45 Rfactor 0.21
    Waters 957 Solvent Content 49.83

    Ligand Information
    Ligands NO3 (NITRATE) x 3;GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 7


    Google Scholar output for 2ejw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch