The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein (TTHA0227) from Thermo thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ejq Target Id ttk003001407.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14718, Molecular Weight 14781.67 Da.
    Residues 130 Isoelectric Point 4.53
    Sequence mtyeafvelverlweevpedfkrglqgvhvfpeakpepglegvwrlgeyldpgppsafggfedlgrhia lyygsflevagegfdweaevwetllhelrhhleslagrddlvqedlrrldafrrggpsgeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.08 Rfree 0.251
    Matthews' coefficent 2.43 Rfactor 0.235
    Waters 111 Solvent Content 49.45

    Ligand Information
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 2ejq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch