.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ejm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of RUH-072, an apo-biotnyl domain form human acetyl coenzyme A carboxylase. To be Published
    Site RSGI
    PDB Id 2ejm Target Id hsk003002080.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12865, Molecular Weight 9497.36 Da.
    Residues 86 Isoelectric Point 5.72
    Sequence vssqetqggplapmtgtiekvfvkagdkvkagdslmvmiamkmehtikspkdgtvkkvfyregaqanrh tplvefeeeesdkrese
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ejm

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch