The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate. J.Biol.Chem. 283 14739-14750 2008
    Site RSGI
    PDB Id 2ejf Target Id pho001000147.25
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13782, Molecular Weight 25927.95 Da.
    Residues 235 Isoelectric Point 7.82
    Sequence mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgalnrkwespegglwlsivlspk vpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykaiagvlvegkgdkivlgiglnvnnkvpn gatsmklelgsevpllsvfrslitnldrlylnflknpmdilnlvrdnmilgvrvkilgdgsfegiaedi ddfgrliirldsgevkkviygdvslrfl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.44 Rfactor 0.209
    Waters 409 Solvent Content 49.63

    Ligand Information
    Ligands BTN (BIOTIN) x 3;ADN (ADENOSINE) x 2;GOL (GLYCEROL) x 1


    Google Scholar output for 2ejf

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch