.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ej0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase with Pyridoxamine 5'-phosphate. To be published
    Site RSGI
    PDB Id 2ej0 Target Id ttk003000081.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14217, Molecular Weight 34005.17 Da.
    Residues 308 Isoelectric Point 5.95
    Sequence mqikagliwmsgafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfynsakvlrm eipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmvaawewgaylgeeavrkg arlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyvaegsgenlffvrdgvi yalehsvnlegitrdsairiakdlgyevqvvratrdqlymadevfmtgtaaevtpvsmidwrpigrgta gpvalrlrevyleavtgrrpeyegwltyvngq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.60 Rfree 0.194
    Matthews' coefficent 2.99 Rfactor 0.179
    Waters 1577 Solvent Content 58.81

    Ligand Information
    Ligands PMP (4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE) x 6;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 8
    Metals

    Jmol

     
    Google Scholar output for 2ej0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch