.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eiy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th.HB8 Branched-Chain Amino Acid Aminotransferase Complexed with 4-Methylvaleric Acid. To be published
    Site RSGI
    PDB Id 2eiy Target Id ttk003000081.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14216, Molecular Weight 34005.17 Da.
    Residues 308 Isoelectric Point 5.95
    Sequence mqikagliwmsgafvpqeeaktsvlshalhygtsvfegirayetakgpaifrlkehvkrfynsakvlrm eipfapeeleeaikevvrrngyrscyirplawmgakalgvnplpnnpaevmvaawewgaylgeeavrkg arlitsswarfpanvmpgkakvggnyvnsalakmeavaagadeallldeegyvaegsgenlffvrdgvi yalehsvnlegitrdsairiakdlgyevqvvratrdqlymadevfmtgtaaevtpvsmidwrpigrgta gpvalrlrevyleavtgrrpeyegwltyvngq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.35 Rfree 0.201
    Matthews' coefficent 2.94 Rfactor 0.189
    Waters 913 Solvent Content 58.20

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 3;4MV (4-METHYL) x 3;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 5
    Metals

    Jmol

     
    Google Scholar output for 2eiy

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch