.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eiv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the arginase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2eiv Target Id ttk003000367.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14351, Molecular Weight 31227.41 Da.
    Residues 291 Isoelectric Point 5.94
    Sequence mervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrgrglaylee iraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetspsgnvhgm plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgvariaeevlkh lqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqsldlvevnpildernrtae mlvglalsllgkrif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.91 Rfree 0.269
    Matthews' coefficent 2.51 Rfactor 0.232
    Waters 175 Solvent Content 51.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eiv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch