.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eii

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of delta1-pyrroline-5-carboxylate dehydrogenase in ternary complex with inhibitor and NAD. To be Published
    Site RSGI
    PDB Id 2eii Target Id ttk003000033.10
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14178, Molecular Weight 57043.17 Da.
    Residues 516 Isoelectric Point 5.57
    Sequence mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsapsevvgtta kagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatlvyevgknwveasadvaea idfieyyaraalryrypavevvpypgednesfyvplgagvviapwnfpvaiftgmivgpvavgntviak paedavvvgakvfeifheagfppgvvnflpgvgeevgaylvehprirfinftgslevglkiyeaagrla pgqtwfkrayvetggkdaiivdetadfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkr aerlsvgpaeenpdlgpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkaria qeeifgpvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalvgvq pfggfklsgtnaktgaldylrlflemkavaerf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.16812
    Matthews' coefficent 2.45 Rfactor 0.13385
    Waters 984 Solvent Content 49.77

    Ligand Information
    Ligands ACT (ACETATE) x 4;VAL (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;NAD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 2;MPD x 14
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2eii

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch