The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of putative NAD-dependent alchol dehydrogenase from Thermus thermophilus HB8. To be published
    Site RSGI
    PDB Id 2eih Target Id ttk003000324.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14335, Molecular Weight 36418.16 Da.
    Residues 343 Isoelectric Point 8.59
    Sequence mravvmrarggpevlevadlpvpepgpkevrvrlkaaalnhldvwvrkgvaspklplphvlgadgsgvv davgpgvegfapgdevvinpglscgrcerclagednlcpryqilgehrhgtyaeyvvlpeanlapkpkn lsfeeaaaipltfltawqmvvdklgvrpgddvlvmaagsgvsvaaiqiaklfgarviatagsedklrra kalgadetvnythpdwpkevrrltggkgadkvvdhtgalyfegvikatanggriaiagassgyegtlpf ahvfyrqlsilgstmasksrlfpilrfveegklkpvvgqvlpleaaaeghrlleerrvfgkvvlqvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.267
    Matthews' coefficent 2.50 Rfactor 0.210
    Waters 251 Solvent Content 50.89

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2eih

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch