The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical proteim (TTHB059) from Thermo thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2ehw Target Id ttk003001685.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14777, Molecular Weight 13779.10 Da.
    Residues 120 Isoelectric Point 5.55
    Sequence machelsalriaigellekeahdllhereelapvlgqrpelkrlaeaktlpaleealreallhleeraa qepeepywrglllaveamegrlkalraeaealyqdldalhgrlhrlfprrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.22 Rfree 0.284
    Matthews' coefficent 2.05 Rfactor 0.220
    Waters 164 Solvent Content 39.98

    Ligand Information


    Google Scholar output for 2ehw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch