.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eht

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of acyl carrier protein from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2eht Target Id aae001011717.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12095, Molecular Weight 8710.40 Da.
    Residues 78 Isoelectric Point 4.11
    Sequence msleervkeiiaeqlgvekekitpeakfvedlgadsldvvelimafeeefgieipdedaekiqtvgdvi nylkekvgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.225
    Matthews' coefficent 2.00 Rfactor 0.196
    Waters 128 Solvent Content 38.40

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;ZN (ZINC) x 7

    Jmol

     
    Google Scholar output for 2eht

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch