.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ehq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title New insights into the binding mode of coenzymes: structure of Thermus thermophilus Delta1-pyrroline-5-carboxylate dehydrogenase complexed with NADP+. Acta Crystallogr.,Sect.F 63 462-465 2007
    Site RSGI
    PDB Id 2ehq Target Id ttk003000033.15
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14181, Molecular Weight 57043.17 Da.
    Residues 516 Isoelectric Point 5.57
    Sequence mtvepfrnepietfqteearramrealrrvreefgrhyplyiggewvdtkermvslnpsapsevvgtta kagkaeaeaaleaawkafktwkdwpqedrsrlllkaaalmrrrkreleatlvyevgknwveasadvaea idfieyyaraalryrypavevvpypgednesfyvplgagvviapwnfpvaiftgmivgpvavgntviak paedavvvgakvfeifheagfppgvvnflpgvgeevgaylvehprirfinftgslevglkiyeaagrla pgqtwfkrayvetggkdaiivdetadfdlaaegvvvsaygfqgqkcsaasrliltqgayepvlervlkr aerlsvgpaeenpdlgpvvsaeqerkvlsyieigknegqlvlggkrlegegyfiaptvftevppkaria qeeifgpvlsvirvkdfaealevandtpygltggvysrkrehlewarrefhvgnlyfnrkitgalvgvq pfggfklsgtnaktgaldylrlflemkavaerf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.18039
    Matthews' coefficent 2.46 Rfactor 0.15804
    Waters 1060 Solvent Content 50.06

    Ligand Information
    Ligands ACT (ACETATE) x 4;NAP (NADP) x 2;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 7
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 2ehq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch