.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ehp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Putative protein (AQ1627) from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2ehp Target Id aae001001627.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12077, Molecular Weight 13713.20 Da.
    Residues 126 Isoelectric Point 4.99
    Sequence mpaifthegkvegvpgnypltaenlfriglalctlwildkeieeptlsipetnfvtlalsvgfmnaggs vnvgkggdiklflqkgeiyvlefqplsetdikklesilfgrapipkktgedigsfkc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.240
    Matthews' coefficent 2.18 Rfactor 0.227
    Waters 150 Solvent Content 43.59

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ehp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch