.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ehj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Uracil phosphoribosyl transferase. To be Published
    Site RSGI
    PDB Id 2ehj Target Id eco002002483.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12281, Molecular Weight 22532.04 Da.
    Residues 208 Isoelectric Point 5.32
    Sequence mkivevkhplvkhklglmreqdistkrfrelasevgslltyeatadletekvtiegwngpveidqikgk kitvvpilraglgmmdgvlenvpsarisvvgmyrneetlepvpyfqklvsnidermalivdpmlatggs viatidllkkagcssikvlvlvaapegiaalekahpdvelytasidqglnehgyiipglgdagdkifgtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.229
    Matthews' coefficent 3.08 Rfactor 0.21
    Waters 85 Solvent Content 60.09

    Ligand Information
    Ligands SO4 (SULFATE) x 19
    Metals

    Jmol

     
    Google Scholar output for 2ehj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch