The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of putative oxidoreductase from Thermus thermophilus HB8. to be published
    Site RSGI
    PDB Id 2ehd Target Id ttk003000296.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14324, Molecular Weight 24490.92 Da.
    Residues 234 Isoelectric Point 6.93
    Sequence megmkgavlitgasrgigeatarllhakgyrvglmardekrlqalaaelegalplpgdvreegdwarav aameeafgelsalvnnagvgvmkpvheltleewrlvldtnltgaflgirhavpallrrgggtivnvgsl agknpfkggaaynaskfgllglagaamldlreanvrvvnvlpgsvdtgfagntpgqawklkpedvaqav lfalempghamvseielrptrptsgpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.255
    Matthews' coefficent 2.92 Rfactor 0.226
    Waters 101 Solvent Content 57.88

    Ligand Information
    Metals CO (COBALT) x 2


    Google Scholar output for 2ehd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch