.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ehc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of diphthine synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2ehc Target Id pho001000725.55
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13907, Molecular Weight 29588.85 Da.
    Residues 265 Isoelectric Point 5.93
    Sequence mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsredvelnfek ivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysavgitglhiykfgksatvay pegnwfptsyydvikenaerglhtllfldikaekrmymtaneamelllkvedmkkggvftddtlvvvla ragslnptiragyvkdliredfgdpphilivpgklhiveaeylveiagapreilrvnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.213
    Matthews' coefficent 3.18 Rfactor 0.198
    Waters 545 Solvent Content 61.28

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1;SO4 (SULFATE) x 8;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2;GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 2ehc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch