.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Stage V Sporolation Protein S (SpoVS) from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2eh1 Target Id ttk003001283.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14676, Molecular Weight 9663.68 Da.
    Residues 90 Isoelectric Point 9.16
    Sequence metlrvssksrpnsvagaiaallrtkgevevqaigpqavnqavkaiaiargyiapdnldlvvkpafvkl eleneertalkfsikahplet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.223
    Matthews' coefficent 3.07 Rfactor 0.199
    Waters 73 Solvent Content 59.92

    Ligand Information
    Ligands ACT (ACETATE) x 6
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2eh1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch