The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 3-dehydroquinate dehydratase from Aquifex aeolicus VF5. To be Published
    Site RSGI
    PDB Id 2egz Target Id aae001000021.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12016, Molecular Weight 24969.43 Da.
    Residues 219 Isoelectric Point 5.90
    Sequence mliavplddtnfsenlkkakekgadivelrvdqfsdtslnyvkekleevhsqglktiltirspeeggre vknreelfeelsplsdytdielssrgllvklynitkeagkkliisyhnfeltppnwiirevlregyryg gipkiavkansyedvarllcisrqvegekilismgdygkisrlagyvfgsvitycslekafapgqiple emvelrkkfyrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.237
    Matthews' coefficent 2.13 Rfactor 0.22
    Waters 123 Solvent Content 42.18

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 2


    Google Scholar output for 2egz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch