.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of O-acetylserine sulfhydrase from Geobacillus kaustophilus HTA426. To be Published
    Site RSGI
    PDB Id 2egu Target Id gka001000065.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12287, Molecular Weight 32709.70 Da.
    Residues 310 Isoelectric Point 5.86
    Sequence ghmartvnsiteligdtpavklnrivdedsadvylklefmnpgssvkdrialamieaaekagklkpgdt iveptsgntgiglamvaaakgykavlvmpdtmslerrnllraygaelvltpgaqgmrgaiakaeelvre hgyfmpqqfkneanpeihrlttgkeiveqmgdqldafvagvgtggtitgagkvlreaypnikiyavepa dspvlsggkpgphkiqgigagfvpdildtsiydgvitvtteeafaaarraareegilggissgaaihaa lkvakelgkgkkvlaiipsngerylstplyqfed
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.219
    Matthews' coefficent 2.55 Rfactor 0.201
    Waters 246 Solvent Content 51.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2egu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch