.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein(AQ1494) from Aquifex aeolicus. To be Published
    Site RSGI
    PDB Id 2egr Target Id aae001001494.3
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12069, Molecular Weight 15284.93 Da.
    Residues 128 Isoelectric Point 7.76
    Sequence mpfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayceykkplfy ddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipkevlevlkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24455
    Matthews' coefficent 2.63 Rfactor 0.21993
    Waters 162 Solvent Content 53.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2egr

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch