.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fourth LIM domain from human four and a half LIM domains 1. To be Published
    Site RSGI
    PDB Id 2egq Target Id hsi002013860.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12503, Molecular Weight 7929.78 Da.
    Residues 70 Isoelectric Point 8.97
    Sequence dcyknfvakkcagcknpitgfgkgssvvayegqswhdycfhckkcsvnlankrfvfhqeqvycpdcakkl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2egq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch