.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RING-finger domain from human Tripartite motif protein 34. To be Published
    Site RSGI
    PDB Id 2egp Target Id hso002001611.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12987, Molecular Weight 7722.39 Da.
    Residues 72 Isoelectric Point 4.93
    Sequence nvqeevtcpiclellteplsldcghslcracitvsnkeavtsmggksscpvcgisysfehlqanqhlan ive
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2egp

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch