.
The Open Protein Structure Annotation Network
PDB Keyword
.

2egg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Shikimate 5-Dehydrogenase (AroE) from Geobacillus kaustophilus. To be Published
    Site RSGI
    PDB Id 2egg Target Id gka001002524.1
    Molecular Characteristics
    Source Geobacillus kaustophilus
    Alias Ids TPS12313, Molecular Weight 32830.82 Da.
    Residues 297 Isoelectric Point 6.68
    Sequence mgsshhhhhhssgenlyfqghmekvygligfpvehslsplmhndafarlgiparyhlfsvepgqvgaai agvralgiagvnvtiphklavipfldevdeharrigavntiinndgrlvgyntdglgyvqaleeemnit ldgkrilvigagggargiyfsllstaaeridmanrtvekaerlvregderrsayfslaeaetrlaeydi iinttsvgmhprvevqplslerlrpgvivsdiiynpletkwlkeakargarvqngvgmlvyqgalafek wtgqwpdvnrmkqlviealrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.255
    Matthews' coefficent 3.19 Rfactor 0.218
    Waters 402 Solvent Content 61.43

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2egg

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch