The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fifth SH3 domain from human KIAA0418 protein. To be Published
    Site RSGI
    PDB Id 2egc Target Id hsk002100407.4
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12707, Molecular Weight 7157.63 Da.
    Residues 62 Isoelectric Point 4.41
    Sequence nlkdvyvsiadyegdeetagfqegvsmevlernpngwwycqildgvkpfkgwvpsnylekkn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2egc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch