.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eg1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of PII protein. To be Published
    Site RSGI
    PDB Id 2eg1 Target Id aae001000109.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12022, Molecular Weight 12495.98 Da.
    Residues 112 Isoelectric Point 5.51
    Sequence mkkieaiikpfkldevkdalveigiggmtvtevkgfgqqkghteiyrgteyvidflpkvkievvvrded vekvvetivktaqtgrvgdgkifiipvedvirirtgergeqai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.223
    Matthews' coefficent 1.77 Rfactor 0.185
    Waters 82 Solvent Content 30.56

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2eg1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch