.
The Open Protein Structure Annotation Network
PDB Keyword
.

2efk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Curved EFC/F-BAR-Domain Dimers Are Joined End to End into a Filament for Membrane Invagination in Endocytosis. Cell(Cambridge,Mass.) 129 761-772 2007
    Site RSGI
    PDB Id 2efk Target Id hss001002741.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13305, Molecular Weight 34067.64 Da.
    Residues 294 Isoelectric Point 6.25
    Sequence qfevlerhtqwgldlldryvkfvkerteveqayakqlrslvkkylpkrpakddpeskfsqqqsfvqilq evndfagqrelvaenlsvrvcleltkysqemkqerkmhfqegrraqqqlengfkqlenskrkferdcre aekaaqtaerldqdinatkadvekakqqahlrshmaeeskneyaaqlqrfnrdqahfyfsqmpqifdkl qdmderratrlgagygllseaelevvpiiakclegmkvaanavdpkndshvlielhksgfarpgdvefe dfsqpmnrapsdsslgtp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.279
    Matthews' coefficent 2.99 Rfactor 0.228
    Waters 139 Solvent Content 58.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2efk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch