.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ef7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ST2348, a CBS domain protein, from hyperthermophilic archaeon Sulfolobus tokodaii. Biochem.Biophys.Res.Commun. 375 124-128 2008
    Site RSGI
    PDB Id 2ef7 Target Id sto001002348.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14062, Molecular Weight 14797.45 Da.
    Residues 133 Isoelectric Point 5.27
    Sequence meeeivkeymktqvisvtkdaklndiakvmteknigsvivvdgnkpvgiiterdivkaigkgksletka eefmtaslitiredspitgalalmrqfnirhlpvvddkgnlkgiisirditraiddmfetmgey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.26
    Matthews' coefficent 2.37 Rfactor 0.216
    Waters 134 Solvent Content 48.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ef7

    Protein Summary

    See entry 1vr9 and Ragunathan 2008.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch