.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ef4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the arginase from thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ef4 Target Id ttk003000367.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14353, Molecular Weight 31227.41 Da.
    Residues 291 Isoelectric Point 5.94
    Sequence mervavvgvpmdlganrrgvdmgpsalryarlleqledlgytvedlgdvpvslarasrrrgrglaylee iraaalvlkerlaalpegvfpivlggdhslsmgsvagaargrrvgvvwvdahadfntpetspsgnvhgm plavlsglghprltevfravdpkdvvlvgvrsldpgekrllkeagvrvytmhevdrlgvariaeevlkh lqglplhvsldadvldptlapgvgtpvpggltyreahllmeilaesgrvqsldlvevnpildernrtae mlvglalsllgkrif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.259
    Matthews' coefficent 2.40 Rfactor 0.254
    Waters 100 Solvent Content 48.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ef4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch