The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ornithine carbamoyltransferase from thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2ef0 Target Id ttk003000041.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14201, Molecular Weight 33233.43 Da.
    Residues 301 Isoelectric Point 6.43
    Sequence mggealtlpkdlldfsgygpkelqalldlaeqlkreryrgedlkgkvlallfekpslrtrttlevamvh lgghavyldqkqvgigerepvrdvaknlerfvegiaarvfrhetvealarhakvpvvnalsdrahplqa ladlltlkevfgglaglevawvgdgnnvlnsllevaplaglkvrvatpkgyepdpgllkranaffthdp keaalgahalytdvwtsmgqeaerekrlrdfqgfqvngellkllrpegvflhclpahygeetteeavhg prsrvfdqaenrlhtakavlltllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.236
    Matthews' coefficent 2.05 Rfactor 0.2
    Waters 141 Solvent Content 40.12

    Ligand Information
    Metals NA (SODIUM) x 1;MG (MAGNESIUM) x 1


    Google Scholar output for 2ef0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch