.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eer

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of Project ID ST2577 from Sulfolobus tokodaii strain7. To be Published
    Site RSGI
    PDB Id 2eer Target Id sto001002577.1
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS14064, Molecular Weight 37567.42 Da.
    Residues 347 Isoelectric Point 6.62
    Sequence mramrlveigkplkledipipkpkgsqvlikieaagvchsdvhmrqgrfgnlrivedlgvklpvtlghe iagrieevgdevvgyskgdlvavnpwegegncyycrigeehlcdsprwlginydgayaeyvlvphykyl yklrrlsaveaapltcsgvttyravrkasldpsktlvvigaggglgtmaiqiakavsgatiigvdvree aleaakragadyvinassqdpvseirritqgkgadavidlnnsektlsiypyvlakqgkyvmvglfgad lkyhaplitlnevqfigslvgnqsdflgimslaeagkvkpmvtktmkleeaneaidnlenfkavgrqvlvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.222
    Matthews' coefficent 2.05 Rfactor 0.18
    Waters 480 Solvent Content 39.87

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2eer

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch