.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eeo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th. HB8 L-Aspartate-alpha-Decarboxylase. To be Published
    Site RSGI
    PDB Id 2eeo Target Id ttk003000264.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14314, Molecular Weight 13094.34 Da.
    Residues 120 Isoelectric Point 5.74
    Sequence mkrvmfhakihratvtqadlhyvgsvtvdqdlldaagilpfeqvdiyditngarlttyalpgergsgvi gingaaahlvkpgdlvilvaygvfdeeearnlkptvvlvdernrilevrkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.2
    Matthews' coefficent 2.16 Rfactor 0.18
    Waters 122 Solvent Content 43.02

    Ligand Information
    Ligands PYR (PYRUVIC) x 1;FMR (FUMARATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2eeo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch