The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1819 protein from Pyrococcus Horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2een Target Id pho001001819.2
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14007, Molecular Weight 22092.28 Da.
    Residues 183 Isoelectric Point 5.15
    Sequence myevelkgyandeifekvretfefmrkeihediyyqhpcrdfsktdealririkrfnghnevfltykgp kideksktrleieveiqedvdkyfelldrlgfkevlkvvktrekyyvekgvtitldeveglgkfieiet lvkekdeipeaveklekilrelgvekferrsylelllekrtelni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.244
    Matthews' coefficent 2.10 Rfactor 0.229
    Waters 394 Solvent Content 41.32

    Ligand Information


    Google Scholar output for 2een

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch