.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eef

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the CBM_21 domain from human protein phosphatase 1, regulatory (inhibitor) subunit 3B. To be Published
    Site RSGI
    PDB Id 2eef Target Id hso003013391.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13168, Molecular Weight 17233.38 Da.
    Residues 149 Isoelectric Point 5.41
    Sequence aesesfvldfsqpsadyldfrnrlqadhvclencvlkdkaiagtvkvqnlafektvkirmtfdtwksyt dfpcqyvkdtyagsdrdtfsfdislpekiqsyermefavyyecngqtywdsnrgknyriiraelkstqg mtkphsgpdlg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eef

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch