The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-teruminus extended RhoGAP domain from human Rho GTPase activating protein 5 variant. To be Published
    Site RSGI
    PDB Id 2ee5 Target Id hsk003002116.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12868, Molecular Weight 24637.91 Da.
    Residues 212 Isoelectric Point 5.52
    Sequence knfnpptrrnwesnyfgmplqdlvtaekpiplfvekcvefiedtglcteglyrvsgnktdqdniqkqfd qdhninlvsmevtvnavagalkaffadlpdplipyslhpelleaakipdkterlhalkeivkkfhpvny dvfryvithlnrvsqqhkinlmtadnlsicfwptlmrpdfenreflsttkihqsvvetfiqqcqfffyn geive
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ee5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch