.
The Open Protein Structure Annotation Network
PDB Keyword
.

2edz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the PDZ domain of mus musculus PDZ domain-containing protein 1. To be Published
    Site RSGI
    PDB Id 2edz Target Id mmt008001486.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13655, Molecular Weight 11988.90 Da.
    Residues 107 Isoelectric Point 5.02
    Sequence mastfnprecklskqegqnygfflriekdtdghlirvieegspaekaglldgdrvlringvfvdkeeha qvvelvrksgnsvtllvldgdsyekavknqvdlkeldq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2edz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch