The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ig-like domain (3361-3449) of human obscurin. To be Published
    Site RSGI
    PDB Id 2edr Target Id hsk002001528.10
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12660, Molecular Weight 9649.34 Da.
    Residues 89 Isoelectric Point 6.35
    Sequence pahfigrlrhqesiegatatlrcelskaapvewrkgreslrdgdrhslrqdgavcelqicglavadage yscvcgeertsatltvkalp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2edr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch