The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second fibronectin type III domain of human Netrin receptor DCC. To be Published
    Site RSGI
    PDB Id 2ed8 Target Id hso002001052.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12946, Molecular Weight 10204.89 Da.
    Residues 93 Isoelectric Point 4.64
    Sequence pgpvenlqavstsptsilitweppayangpvqgyrlfctevstgkeqnievdglsykleglkkfteysl rflaynrygpgvstdditvvtlsd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ed8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch