The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the flavin reductase component (HpaC) of 4-hydroxyphenylacetate 3-monooxygenase from Thermus thermophilus HB8: Structural basis for the flavin affinity. Proteins 70 718-730 2008
    Site RSGI
    PDB Id 2ed4 Target Id ttk003001207.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14662, Molecular Weight 16109.78 Da.
    Residues 149 Isoelectric Point 5.97
    Sequence mkeafkealarfasgvtvvaarlgeeergmtatafmslslepplvalavserakllpvlegagaftvsl lregqeavsehfagrpkegialeegrvkgalavlrcrlhalypggdhrivvglveevelgeegpplvyf qrgyrrlvwps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.213
    Matthews' coefficent 2.12 Rfactor 0.177
    Waters 271 Solvent Content 41.88

    Ligand Information


    Google Scholar output for 2ed4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch