The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Zinc finger, C3HC4 type (RING finger) domain Tripartite motif protein 30. To be Published
    Site RSGI
    PDB Id 2ecw Target Id mmi002016417.2
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13394, Molecular Weight 8640.52 Da.
    Residues 78 Isoelectric Point 5.60
    Sequence massvlemikeevtcpiclellkepvsadcnhsfcracitlnyesnrntdgkgncpvcrvpypfgnlkp nlhvanive
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ecw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch