.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ecq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 3-Hydroxylactate. to be published
    Site RSGI
    PDB Id 2ecq Target Id ttk003000030.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14175, Molecular Weight 33023.37 Da.
    Residues 304 Isoelectric Point 6.39
    Sequence mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpgsgqvivept sgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrmlaareealrlkeelgafm pdqfknpanvrahyettgpelyealegridafvygsgtggtitgvgrylkeriphvkviaveparsnvl sggkmgqhgfqgmgpgfipenldlslldgviqvweedafplarrlareeglflgmssggivwaalqvar elgpgkrvacispdggwkylstplyaep
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.2
    Matthews' coefficent 3.80 Rfactor 0.179
    Waters 336 Solvent Content 67.67

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1;3HL ((3S)-3-HYDROXYBUTANOIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2ecq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch