The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RING domain of the RING finger and CHY zinc finger domain-containing protein 1 from Mus musculus. To be Published
    Site RSGI
    PDB Id 2ecm Target Id mmt007120724.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13612, Molecular Weight 4839.48 Da.
    Residues 42 Isoelectric Point 6.43
    Sequence cpicledihtsrvvahvlpcghllhrtcyeemlkegyrcplc
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2ecm

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch