.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ecb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the third homeobox domain of human Zinc fingers and homeoboxes protein. To be Published
    Site RSGI
    PDB Id 2ecb Target Id hso003001990.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13034, Molecular Weight 8816.48 Da.
    Residues 76 Isoelectric Point 8.59
    Sequence pdftpqkfkektaeqlrvlqasflnssvltdeelnrlraqtkltrreidawftekkkskalkeekmeid esnagss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ecb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch