The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RGS domain from human Regulator of G-protein signaling 12 (RGS12). To be Published
    Site RSGI
    PDB Id 2ebz Target Id hsk003002628.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12889, Molecular Weight 17339.76 Da.
    Residues 148 Isoelectric Point 5.95
    Sequence rerrvaswavsferllqdpvgvryfsdflrkefseenilfwqaceyfnhvpahdkkelsyrareifskf lcskattpvnidsqaqladdvlraphpdmfkeqqlqifnlmkfdsytrflksplyqecilaevegralp dsqqvpsspa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2ebz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch