.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein from E. Coli. To be Published
    Site RSGI
    PDB Id 2eby Target Id eco002000472.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12274, Molecular Weight 13689.85 Da.
    Residues 120 Isoelectric Point 5.74
    Sequence gssgssgmkqatrkpttpgdillyeylepldlkinelaellhvhrnsvsalinnnrklttemafrlakv fdttvdfwlnlqaavdlwevennmrtqeelgrietvaeylarreerakkva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.25 Rfree 0.248
    Matthews' coefficent 2.39 Rfactor 0.228
    Waters 59 Solvent Content 48.60

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2eby

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch